PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000823458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 291aa    MW: 32932 Da    PI: 4.6593
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000823458genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-173582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l d+v+ +G g+W++ a + g++Rt+k+c++rw++yl
    MDP0000823458 35 KGPWTAEEDSILNDYVNIHGEGRWNSLACHAGLKRTGKSCRLRWLNYL 82
                     79********************************************97 PP

2Myb_DNA-binding47.73.6e-1588131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++++++++ ++G++ W++Ia++++ gRt++++k++w++
    MDP0000823458  88 RGNITLQEQLIILQLHSRWGNR-WSKIAEYLP-GRTDNEIKNYWRT 131
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7083082IPR017930Myb domain
SuperFamilySSF466891.65E-3032129IPR009057Homeodomain-like
SMARTSM007172.1E-133484IPR001005SANT/Myb domain
PfamPF002491.1E-153582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-233689IPR009057Homeodomain-like
CDDcd001671.09E-103782No hitNo description
PROSITE profilePS5129422.3683137IPR017930Myb domain
SMARTSM007171.7E-1387135IPR001005SANT/Myb domain
PfamPF002495.5E-1488131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2190136IPR009057Homeodomain-like
CDDcd001672.38E-1092131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDINNVHDQM RSARYGSLAA AATHDQPIEG LDLRKGPWTA EEDSILNDYV NIHGEGRWNS  60
LACHAGLKRT GKSCRLRWLN YLRPNVQRGN ITLQEQLIIL QLHSRWGNRW SKIAEYLPGR  120
TDNEIKNYWR TRVQKQAKQL KCDVNSKQFQ DAMRYVWIPR LIERIGSLPE AVPEQPSTCI  180
TTTSESECQY LVDPNFVPET SXSTSSESYD QVQVCSIPAD PTSSGDEFMT YPSSGQYGSE  240
NGSGCSQNGI NSDIDGFEQS NYWSTGGDTS VENLWTEENI WFLQQQLSDD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262613718128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008343185.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-71MY108_ARATH; Transcription factor MYB108
TrEMBLM5XUE41e-140M5XUE4_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s19250.16e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.11e-75myb domain protein 2